PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM08G10180.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 783aa    MW: 86350.8 Da    PI: 8.3382
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM08G10180.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.31.5e-1963118257
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
         Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                      r+ + +t +q e+L+++F+++++p++++ ++LAk+l++te+q+k+WFqN R+k+kk
  OGLUM08G10180.2  63 RRYQLLTMQQKETLNRAFQSCPNPDRNDLKKLAKELNMTETQIKYWFQNCRTKMKK 118
                      6677899************************************************8 PP

2START104.81.5e-332694977204
                      HHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEEC CS
            START   7 aqelvkkalaeepgWvkss.....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevis 86 
                      ++e++ k +++ p+W         es+n++e+l k  +  +     +++ + r++++v + +++lv++lld + +W e ++    +a t++ is
  OGLUM08G10180.2 269 ENESLVKKKENGPLWLPHMdilgvESLNYQEYLAKSRTI-GqkpvdFKVVVTRDTAIVNGSCVDLVKSLLDAN-RWRELFPgivaSANTTKIIS 360
                      5666777788899999888899999********999553.3589999**************************.******99999********* PP

                      TT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..........-TTSEE...-EESSEEEEEEEECTCE CS
            START  87 sg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.........sssvvR...aellpSgiliepksngh 161
                      +g      g lqlm aelq++sp vp  d++f+R++ q g g w +vd S+d   + ++         ss  +R   ++llpSg++ie+++ng+
  OGLUM08G10180.2 361 TGlsnlhdGLLQLMRAELQVMSPEVPvCDVTFLRQSVQFGSGLWCVVDASIDTILPGESktaqsivqtSSTAARrmeVRLLPSGCVIEEMENGY 454
                      ***************************************************98777766653333443222223455899************** PP

                      EEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXX CS
            START 162 skvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqc 204
                      sk+tw+ h+ +++r ++ l++sl++s  a ga +wva lqr+ 
  OGLUM08G10180.2 455 SKLTWMVHAAYDERAVPVLYHSLLRSAKALGACRWVASLQRHS 497
                      *****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-1549101IPR009057Homeodomain-like
SuperFamilySSF466898.77E-1851120IPR009057Homeodomain-like
PROSITE profilePS5007115.74259119IPR001356Homeobox domain
SMARTSM003891.9E-1761123IPR001356Homeobox domain
CDDcd000865.27E-1862118No hitNo description
PfamPF000464.1E-1763118IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.5E-4102144IPR009057Homeodomain-like
CDDcd146864.52E-4110147No hitNo description
PROSITE profilePS5084823.672245502IPR002913START domain
CDDcd088752.61E-90249498No hitNo description
SuperFamilySSF559619.06E-19249497No hitNo description
SMARTSM002342.8E-10261499IPR002913START domain
PfamPF018521.2E-26269497IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 783 aa     Download sequence    Send to blast
MDGELKLMAS YVSKLKFILQ KDQQQEPHTA NLLVLLGSSN QDKRNGLSQG ENRMDTCTRK  60
KPRRYQLLTM QQKETLNRAF QSCPNPDRND LKKLAKELNM TETQIKYWFQ NCRTKMKKFK  120
NNEERKLLQK ENEELKKENA ELRNRMKNST CRACDLPLFH IDCRHWENPM LNKGNHGVTS  180
NLIPQAVSSL LPSSSGFVAS GSNLSSNAVL MPVSAMPSSV LQPAPAVSGA NFPILHNLSA  240
NANDGYTEKN VLLDLANRAM EEFFSLMKEN ESLVKKKENG PLWLPHMDIL GVESLNYQEY  300
LAKSRTIGQK PVDFKVVVTR DTAIVNGSCV DLVKSLLDAN RWRELFPGIV ASANTTKIIS  360
TGLSNLHDGL LQLMRAELQV MSPEVPVCDV TFLRQSVQFG SGLWCVVDAS IDTILPGESK  420
TAQSIVQTSS TAARRMEVRL LPSGCVIEEM ENGYSKLTWM VHAAYDERAV PVLYHSLLRS  480
AKALGACRWV ASLQRHSQFL SGLHKYIFCP DSTKVVMRRK VLYLVKQMTS SFTGLFASMS  540
KATLQDGDDT HFAHQIVGGA TGEPAGLLLS ATTTIWLPGV NPRRVYDHLR DEQCHGEWRC  600
LLGEQLHQGN ALPYGAPLNG ETVPEFYRMV NGLHEGHAIS LISPREMGGN ISNTLLLQEA  660
RTDLSGSLIV YARTDVNTVH SIMNSGLNPA TVFLVSSGCA ILPDCLESFP LHPAATADQA  720
GTSSAAIASR SETGGSFVTV TYQMFFSSQG GAAPASSSIH QGRDALKKAT DIFKVVLDTL  780
TVA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1004410.0AK100441.1 Oryza sativa Japonica Group cDNA clone:J023089M04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650917.10.0PREDICTED: homeobox-leucine zipper protein ROC6-like isoform X2
TrEMBLA0A0E0ATG70.0A0A0E0ATG7_9ORYZ; Uncharacterized protein
STRINGLOC_Os08g19590.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.19e-92HD-ZIP family protein